PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09838.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 182aa    MW: 21209.7 Da    PI: 6.5199
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09838.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.96.3e-20350148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+++++ +G ++Wkt+a + g++R++k+c++rw++yl
       KHN09838.1  3 RGAWTPEEDRKLAQCIEIHGAKRWKTVAIKSGLNRCGKSCRLRWLNYL 50
                     89********************************************97 PP

2Myb_DNA-binding52.41.2e-1656101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eE++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       KHN09838.1  56 RGNISDEEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 101
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.26154IPR017930Myb domain
SMARTSM007173.6E-16252IPR001005SANT/Myb domain
SuperFamilySSF466892.85E-29297IPR009057Homeodomain-like
PfamPF002495.9E-18350IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-24457IPR009057Homeodomain-like
CDDcd001673.02E-11550No hitNo description
SMARTSM007175.0E-1455103IPR001005SANT/Myb domain
PROSITE profilePS5129420.16155105IPR017930Myb domain
PfamPF002494.3E-1556101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2558106IPR009057Homeodomain-like
CDDcd001671.36E-1060101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010090Biological Processtrichome morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MNRGAWTPEE DRKLAQCIEI HGAKRWKTVA IKSGLNRCGK SCRLRWLNYL RPNIKRGNIS  60
DEEEDLILRL HRLLGNRWSL IAGRLPGRTD NEIKNYWNSH LCKKVNQKVE KPESSTRHEI  120
IGQNDAGDNR AMSENEVEIN ESSNLDVSSF DVNEFFNFSE ESFGFDWLNK YLELDQIPQS  180
TE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-28110525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4907761e-112AB490776.1 Lotus japonicus LjPAP mRNA for R2R3-MYB transcription factor LjPAP, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549924.11e-132PREDICTED: transcription factor MYB114-like
SwissprotP102901e-50MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0B2PQ941e-133A0A0B2PQ94_GLYSO; Anthocyanin regulatory C1 protein
STRINGGLYMA17G15270.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.11e-50myb domain protein 66
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]